PDB entry 2gjz

View 2gjz on RCSB PDB site
Description: Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1)
Class: immune system
Keywords: immunoglobulin,catalytic antibody, elimination, IMMUNE SYSTEM
Deposited on 2006-03-31, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic elimination antibody 13G5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GJZ (0-216)
    Domains in SCOPe 2.07: d2gjza1, d2gjza2
  • Chain 'B':
    Compound: Catalytic elimination antibody 13G5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GJZ (0-220)
  • Chain 'H':
    Compound: Catalytic elimination antibody 13G5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GJZ (0-220)
  • Chain 'L':
    Compound: Catalytic elimination antibody 13G5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GJZ (0-216)
    Domains in SCOPe 2.07: d2gjzl1, d2gjzl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gjzA (A:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gjzL (L:)
    elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn