PDB entry 2gjj

View 2gjj on RCSB PDB site
Description: Crystal structure of a single chain antibody scA21 against Her2/ErbB2
Class: immune system
Keywords: Ig family, scFv, IMMUNE SYSTEM
Deposited on 2006-03-31, released 2006-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A21 single-chain antibody fragment against erbB2
    Species: Mus musculus [TaxId:10090]
    Gene: scA21
    Database cross-references and differences (RAF-indexed):
    • GB AAL91085 (4-117)
      • expression tag (2-3)
      • linker (118)
      • conflict (141)
      • conflict (230)
    • GB AAL91083 (138-End)
    Domains in SCOPe 2.06: d2gjja1, d2gjja2, d2gjja3
  • Chain 'B':
    Compound: A21 single-chain antibody fragment against erbB2
    Species: Mus musculus [TaxId:10090]
    Gene: scA21
    Database cross-references and differences (RAF-indexed):
    • GB AAL91085 (4-End)
      • expression tag (2-3)
      • conflict (141)
      • conflict (230)
    • GB AAL91083 (138-End)
    Domains in SCOPe 2.06: d2gjjb1, d2gjjb2, d2gjjb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjjA (A:)
    eaeadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspkllisw
    aftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikrgg
    ggsggggsggggsggggsevqlqqsgpevvktgasvkisckasgysftgyfinwvkknsg
    kspewighisssyatstynqkfknkaaftvdtssstafmqlnsltsedsadyycvrsgny
    eeyamdywgqgtsvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjjA (A:)
    eadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswaf
    trksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikrgevq
    lqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstynqk
    fknkaaftvdtssstafmqlnsltsedsadyycvrsgnyeeyamdywgqgtsvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gjjB (B:)
    eaeadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspkllisw
    aftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikrgg
    ggsggggsggggsggggsevqlqqsgpevvktgasvkisckasgysftgyfinwvkknsg
    kspewighisssyatstynqkfknkaaftvdtssstafmqlnsltsedsadyycvrsgny
    eeyamdywgqgtsvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjjB (B:)
    eadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswaf
    trksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikevqlq
    qsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstynqkfk
    nkaaftvdtssstafmqlnsltsedsadyycvrsgnyeeyamdywgqgtsvtvs