PDB entry 2gja

View 2gja on RCSB PDB site
Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and NH4+
Class: hydrolase
Keywords: G-domain dimer, alpha-beta-sandwich, HYDROLASE
Deposited on 2006-03-30, released 2006-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25522 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.04: d2gjaa_
  • Chain 'B':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25522 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.04: d2gjab_
  • Heterogens: ALF, MG, NH4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gjaA (A:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjaA (A:)
    hgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtagl
    reasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvr
    nkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gjaB (B:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjaB (B:)
    hgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtagl
    reasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvr
    nkaditgetlgmsevnghalirlsartgegvdvlrnhlkqs