PDB entry 2gj9

View 2gj9 on RCSB PDB site
Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and Rb+
Class: Hydrolase
Keywords: G-domain dimer, alpha-beta-sandwich, Hydrolase
Deposited on 2006-03-30, released 2006-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.252
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gj9a_
  • Chain 'B':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gj9b_
  • Chain 'C':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gj9c_
  • Chain 'D':
    Compound: tRNA modification GTPase trmE
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Gene: trmE, mnmE, thdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gj9d_
  • Heterogens: ALF, MG, RB, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gj9A (A:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj9A (A:)
    gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
    easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
    kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gj9B (B:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj9B (B:)
    mkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglre
    asdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrnk
    aditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gj9C (C:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj9C (C:)
    gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
    easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
    kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gj9D (D:)
    gshgmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidta
    glreasdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitv
    vrnkaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj9D (D:)
    mkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglre
    asdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrnk
    aditgetlgmsevnghalirlsartgegvdvlrnhlkqsm