PDB entry 2gj7

View 2gj7 on RCSB PDB site
Description: Crystal Structure of a gE-gI/Fc complex
Class: immune system/virus/viral protein
Keywords: Fc receptor, low resolution, IMMUNE SYSTEM-VIRUS-VIRAL PROTEIN COMPLEX
Deposited on 2006-03-30, released 2006-05-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 5 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IgG1 heavy chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (135)
      • conflict (137)
    Domains in SCOPe 2.01: d2gj7a1, d2gj7a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IgG1 heavy chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (135)
      • conflict (137)
    Domains in SCOPe 2.01: d2gj7b1, d2gj7b2
  • Chain 'E':
    Compound: Glycoprotein E
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GE, US8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gj7e1
  • Chain 'F':
    Compound: Glycoprotein E
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GE, US8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gj7f1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gj7A (A:)
    lethtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj7A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gj7B (B:)
    lethtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj7B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gj7E (E:)
    gtpktswrrvsvgedvsllpapgptgrgptqkllwavepldgcgplhpswvslmppkqvp
    etvvdaacmrapvplamayappapsatgglrtdfvwqeraavvnrslvihgvretdsgly
    tlsvgdikdparqvasvvlvvqpapvptppptpadydeddndegedeslagtpasgtprl
    ppppapprswpsapevshvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdv
    vwlrfdvptscaemriyesclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnpp
    prcsaeahmepvpglawqaasvnlefrdaspqhsglylcvvyvndhihawghitistaaq
    yrnavveqplpqrgadlaepthphvgapphappthgalrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj7E (E:)
    rgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriyes
    clyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawqa
    asvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gj7F (F:)
    gtpktswrrvsvgedvsllpapgptgrgptqkllwavepldgcgplhpswvslmppkqvp
    etvvdaacmrapvplamayappapsatgglrtdfvwqeraavvnrslvihgvretdsgly
    tlsvgdikdparqvasvvlvvqpapvptppptpadydeddndegedeslagtpasgtprl
    ppppapprswpsapevshvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdv
    vwlrfdvptscaemriyesclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnpp
    prcsaeahmepvpglawqaasvnlefrdaspqhsglylcvvyvndhihawghitistaaq
    yrnavveqplpqrgadlaepthphvgapphappthgalrdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gj7F (F:)
    rgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriyes
    clyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawqa
    asvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl