PDB entry 2giz

View 2giz on RCSB PDB site
Description: Structural and functional analysis of Natrin, a member of crisp-3 family blocks a variety of ion channels
Class: toxin
Keywords: CRISP, blocker, crystal structure, electrophysiology, docking, TOXIN
Deposited on 2006-03-30, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.225
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natrin-1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2giza1, d2giza2
  • Chain 'B':
    Compound: Natrin-1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gizb1, d2gizb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gizA (A:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gizA (A:)
    sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
    rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
    ragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnpcti
    ynkltncdsllkqsscqddwiksncpascfcrnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gizB (B:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gizB (B:)
    sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
    rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
    ragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnpcti
    ynkltncdsllkqsscqddwiksncpascfcrnkii