PDB entry 2giy

View 2giy on RCSB PDB site
Description: Crystal Structure of the C-terminal domain of the HSV-1 gE ectodomain
Class: viral protein
Keywords: viral Fc receptor, Ig V domain, VIRAL PROTEIN
Deposited on 2006-03-29, released 2006-05-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein E
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GE, US8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04488 (Start-178)
      • cloning artifact (179-184)
    Domains in SCOPe 2.01: d2giya1
  • Chain 'B':
    Compound: Glycoprotein E
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GE, US8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04488 (Start-178)
      • cloning artifact (179-184)
    Domains in SCOPe 2.01: d2giyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2giyA (A:)
    gapevshvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptsc
    aemriyesclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmep
    vpglawqaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpld
    iegrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2giyA (A:)
    hvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriy
    esclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglaw
    qaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpldiegrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2giyB (B:)
    gapevshvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptsc
    aemriyesclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmep
    vpglawqaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpld
    iegrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2giyB (B:)
    vrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriye
    sclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawq
    aasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpldiegrg