PDB entry 2gil

View 2gil on RCSB PDB site
Description: Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
Class: protein transport
Keywords: protein-nucleotide complex, GTPase-fold, PROTEIN TRANSPORT
Deposited on 2006-03-29, released 2006-06-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gila_
  • Chain 'B':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gilb_
  • Chain 'C':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gilc_
  • Chain 'D':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gild_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gilA (A:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdlad
    krqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gilA (A:)
    fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
    rfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
    rqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gilB (B:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdlad
    krqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gilC (C:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdlad
    krqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gilC (C:)
    fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
    rfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
    rqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gilD (D:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdlad
    krqvsieegerkakelnvmfietsakagynvkqlfrrvaaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gilD (D:)
    fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
    rfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladk
    rqvsieegerkakelnvmfietsakagynvkqlfrrvaaal