PDB entry 2gh2

View 2gh2 on RCSB PDB site
Description: 1.5 A Resolution R. Norvegicus Cysteine Dioxygenase Structure Crystallized in the Presence of Cysteine
Class: Oxidoreductase
Keywords: Thioether, Cysteinyl-Tyrosine, Cupin, Beta-Sandwich, Tetrahedral Iron Coordination
Deposited on 2006-03-24, released 2006-04-11
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type I
    Species: Rattus norvegicus
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gh2a1
  • Heterogens: SO4, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gh2A (A:)
    mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh2A (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
    fgirtp