PDB entry 2ggz

View 2ggz on RCSB PDB site
Description: Crystal Structure of Human Guanylate Cyclase Activating Protein-3
Class: lyase activator
Keywords: EF hand, Guanylate Cyclase Activating Protein, GCAP, GCAP3, GCAP-3, LYASE ACTIVATOR
Deposited on 2006-03-24, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.256
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylyl cyclase-activating protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ggza_
  • Chain 'B':
    Compound: Guanylyl cyclase-activating protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ggzb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ggzA (A:)
    ghmgngksiagdqkavptqethvwyrtfmmeypsglqtlhefktllglqglnqkankhid
    qvyntfdtnkdgfvdflefiaavnlimqekmeqklkwyfklydadgngsidknelldmfm
    avqalngqqtlspeefinlvfhkidinndgeltleefingmakdqdlleivyksfdfsnv
    lrvicngkqpdmetdsskspdkaglgkvkmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggzA (A:)
    wyrtfmmeypsglqtlhefktllglqglnqkankhidqvyntfdtnkdgfvdflefiaav
    nlimqekmeqklkwyfklydadgngsidknelldmfmavqalngqqtlspeefinlvfhk
    idinndgeltleefingmakdqdlleivyksfdfsnvlrvicngk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ggzB (B:)
    ghmgngksiagdqkavptqethvwyrtfmmeypsglqtlhefktllglqglnqkankhid
    qvyntfdtnkdgfvdflefiaavnlimqekmeqklkwyfklydadgngsidknelldmfm
    avqalngqqtlspeefinlvfhkidinndgeltleefingmakdqdlleivyksfdfsnv
    lrvicngkqpdmetdsskspdkaglgkvkmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggzB (B:)
    wyrtfmmeypsglqtlhefktllglqglnqkankhidqvyntfdtnkdgfvdflefiaav
    nlimqekmeqklkwyfklydadgngsidknelldmfmavqalngqqtlspeefinlvfhk
    idinndgeltleefingmakdqdlleivyksfdfsnvlrvicngk