PDB entry 2ggx

View 2ggx on RCSB PDB site
Description: Crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein D in complex with p-nitrophenyl maltoside
Class: sugar binding protein
Keywords: protein-carbohydrate ligand complex, SUGAR BINDING PROTEIN
Deposited on 2006-03-24, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ggxa1, d2ggxa2
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ggxb1, d2ggxb2
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ggxc1, d2ggxc2
  • Heterogens: CA, NPJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ggxA (A:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggxA (A:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ggxB (B:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggxB (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ggxC (C:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggxC (C:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef