PDB entry 2ggm

View 2ggm on RCSB PDB site
Description: Human centrin 2 xeroderma pigmentosum group C protein complex
Class: cell cycle
Keywords: EF-Hand Superfamily, DNA repair complex, CELL CYCLE
Deposited on 2006-03-24, released 2006-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CETN2, CALT, CEN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41208 (Start-171)
      • modified residue (56)
      • modified residue (71)
      • modified residue (83)
      • modified residue (92)
      • modified residue (96)
      • modified residue (144)
      • modified residue (165)
    Domains in SCOPe 2.02: d2ggma1
  • Chain 'B':
    Compound: Centrin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CETN2, CALT, CEN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41208
      • modified residue (56)
      • modified residue (71)
      • modified residue (83)
      • modified residue (92)
      • modified residue (96)
      • modified residue (144)
      • modified residue (165)
    Domains in SCOPe 2.02: d2ggmb1
  • Chain 'C':
    Compound: DNA-repair protein complementing XP-C cells
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-repair protein complementing XP-C cells
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ggmA (A:)
    masnfkkanmasssqrkrmspkpelteeqkqeireafdlfdadgtgtidvkelkvamral
    gfepkkeeikkmiseidkegtgkmnfgdfltvmtqkmsekdtkeeilkafklfdddetgk
    isfknlkrvakelgenltdeelqemideadrdgdgevseqeflrimkktsly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggmA (A:)
    elteeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgk
    mnfgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelq
    emideadrdgdgevseqeflrimkktsly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ggmB (B:)
    masnfkkanmasssqrkrmspkpelteeqkqeireafdlfdadgtgtidvkelkvamral
    gfepkkeeikkmiseidkegtgkmnfgdfltvmtqkmsekdtkeeilkafklfdddetgk
    isfknlkrvakelgenltdeelqemideadrdgdgevseqeflrimkktsly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ggmB (B:)
    lteeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkm
    nfgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqe
    mideadrdgdgevseqeflrimkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.