PDB entry 2gfb

View 2gfb on RCSB PDB site
Description: crystal structure of a catalytic fab having esterase-like activity
Deposited on 1994-07-07, released 1994-09-30
The last revision prior to the SCOP 1.63 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbA (A:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbB (B:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbC (C:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbD (D:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbE (E:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbF (F:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbG (G:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbH (H:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbI (I:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbJ (J:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbK (K:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbL (L:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbM (M:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbN (N:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbO (O:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbP (P:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg