PDB entry 2gf9

View 2gf9 on RCSB PDB site
Description: Crystal structure of human RAB3D in complex with GDP
Class: protein transport
Keywords: G-PROTEIN, RAB, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN TRANSPORT
Deposited on 2006-03-21, released 2006-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.153
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-3D
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3D, GOV, RAB16
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95716 (19-188)
      • cloning artifact (13-18)
    Domains in SCOPe 2.04: d2gf9a_
  • Heterogens: MG, UNX, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gf9A (A:)
    mgsshhhhhhssglvprgsdymfklllignssvgktsflfryaddsftpafvstvgidfk
    vktvyrhdkriklqiwdtagqeryrtittayyrgamgfllmydianqesfaavqdwatqi
    ktyswdnaqvilvgnkcdledervvpaedgrrladdlgfeffeasakeninvkqvferlv
    dvicekmne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf9A (A:)
    lvprgsdymfklllignssvgktsflfryaddsftpafvstvgidfkvktvyrhdkrikl
    qiwdtagqeryrtittayyrgamgfllmydianqesfaavqdwatqiktyswdnaqvilv
    gnkcdledervvpaedgrrladdlgfeffeasakeninvkqvferlvdvicekmne