PDB entry 2gf0

View 2gf0 on RCSB PDB site
Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
Class: transport protein
Keywords: DIRAS, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, TRANSPORT PROTEIN
Deposited on 2006-03-21, released 2006-04-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Di-Ras1
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS1, GBTS1, RIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gf0a1
  • Chain 'B':
    Compound: GTP-binding protein Di-Ras1
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS1, GBTS1, RIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gf0b_
  • Chain 'C':
    Compound: GTP-binding protein Di-Ras1
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS1, GBTS1, RIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gf0c_
  • Chain 'D':
    Compound: GTP-binding protein Di-Ras1
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS1, GBTS1, RIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gf0d_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gf0A (A:)
    smpeqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqi
    tdttgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlv
    gnkcdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmslnidg
    krsgkqkrtdrvkgkctlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf0A (A:)
    qsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdtt
    gshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkc
    detqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gf0B (B:)
    smpeqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqi
    tdttgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlv
    gnkcdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmslnidg
    krsgkqkrtdrvkgkctlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf0B (B:)
    eqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdt
    tgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnk
    cdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gf0C (C:)
    smpeqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqi
    tdttgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlv
    gnkcdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmslnidg
    krsgkqkrtdrvkgkctlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf0C (C:)
    ndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdttgs
    hqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkcde
    tqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gf0D (D:)
    smpeqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqi
    tdttgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlv
    gnkcdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmslnidg
    krsgkqkrtdrvkgkctlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf0D (D:)
    ndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdttgs
    hqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkcde
    tqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsl