PDB entry 2get

View 2get on RCSB PDB site
Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with a coenzyme A derivative, Form-I (LT)
Class: transferase
Keywords: HOMODIMER, COA BIOSYNTHESIS, NUCLEOTIDE BINDING, Transferase
Deposited on 2006-03-20, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: coaA(Rv1092c)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63810 (Start-311)
      • modified residue (172)
    Domains in SCOPe 2.07: d2geta_
  • Heterogens: COK, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2getA (A:)
    msrlsepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarli
    hlqvaarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhh
    prvdlvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshl
    hydiipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrfl
    amrttafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkda
    dhsinrlrlrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2getA (A:)
    sepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqv
    aarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvd
    lvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydi
    ipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrt
    tafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsi
    nrlrlrkl