PDB entry 2ge9

View 2ge9 on RCSB PDB site
Description: Solution Structures of the SH2 domain of Bruton's Tyrosine Kinase
Class: transferase
Keywords: SH2 DOMAIN, BTK, Structure, TRANSFERASE
Deposited on 2006-03-18, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ge9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ge9A (A:)
mteaedsiemyewyskhmtrsqaeqllkqegkeggfivrdsskagkytvsvfakstgdpq
gvirhyvvcstpqsqyylaekhlfstipelinyhqhnsaglisrlkypvsqqnknapsth
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ge9A (A:)
teaedsiemyewyskhmtrsqaeqllkqegkeggfivrdsskagkytvsvfakstgdpqg
virhyvvcstpqsqyylaekhlfstipelinyhqhnsaglisrlkypvsqqnknapst