PDB entry 2gdm

View 2gdm on RCSB PDB site
Description: leghemoglobin (oxy)
Deposited on 1994-09-14, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2gdm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdm_ (-)
    galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
    qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
    vvgakwseelnsawtiaydelaivikkemddaa