PDB entry 2gcn

View 2gcn on RCSB PDB site
Description: Crystal structure of the human RhoC-GDP complex
Class: signaling protein
Keywords: GTP-binding protein, GTPase,SIGNALING PROTEIN, SIGNALING PROTEIN
Deposited on 2006-03-14, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-related GTP-binding protein RhoC
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOC, ARH9, ARHC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gcna_
  • Heterogens: MG, GDP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gcnA (A:)
    mgsshhhhhhssglvprgshmaairkklvivgdgacgktcllivfskdqfpevyvptvfe
    nyiadievdgkqvelalwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwt
    pevkhfcpnvpiilvgnkkdlrqdehtrrelakmkqepvrseegrdmanrisafgylecs
    aktkegvrevfematraglqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcnA (A:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    qdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl