PDB entry 2gbv

View 2gbv on RCSB PDB site
Description: C6A/C111A/C57A/C146A holo CuZn Superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, human cu/zn superoxide dismutase, cystein-free
Deposited on 2006-03-11, released 2007-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbva_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvd_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbve_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvf_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvg_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvh_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvi_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.06: d2gbvj_
  • Heterogens: CU1, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvB (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvC (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvD (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvE (E:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvF (F:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvG (G:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvH (H:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvI (I:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbvJ (J:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq