PDB entry 2gbu

View 2gbu on RCSB PDB site
Description: C6A/C111A/C57A/C146A apo CuZn Superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, human cu/zn superoxide dismutase, cystein-free
Deposited on 2006-03-11, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.07: d2gbua_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.07: d2gbub_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.07: d2gbuc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-152)
      • engineered (5)
      • engineered (56)
      • engineered (110)
      • engineered (145)
    Domains in SCOPe 2.07: d2gbud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbuA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbuB (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gbuC (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbuC (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvhekadsrlaagvi
    giaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gbuD (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbuD (D:)
    tkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsag
    phfnprhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvhekadsrlaagvig
    iaq