PDB entry 2gbf

View 2gbf on RCSB PDB site
Description: rat dpp-IV with alkynyl cyanopyrrolidine #1
Class: hydrolase
Keywords: serine peptidase beta propeller, HYDROLASE
Deposited on 2006-03-10, released 2006-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.25
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gbfa1, d2gbfa2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gbfb1, d2gbfb2
  • Heterogens: AIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbfA (A:)
    rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg
    dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq
    eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn
    gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst
    tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc
    pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf
    itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy
    ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvqmpskkldf
    ivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatylasteniiva
    sfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstahqhiyshms
    hflqqcfslr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbfB (B:)
    rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg
    dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq
    eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn
    gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst
    tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc
    pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf
    itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy
    ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvqmpskkldf
    ivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatylasteniiva
    sfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstahqhiyshms
    hflqqcfslr