PDB entry 2gb1

View 2gb1 on RCSB PDB site
Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1991-05-15, released 1993-04-15
The last revision prior to the SCOP 1.73 freeze date was dated 1993-04-15, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. group G
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gb1A (A:)
    mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte