PDB entry 2gb1

View 2gb1 on RCSB PDB site
Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Deposited on 1991-05-15, released 1993-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d2gb1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gb1_ (-)
    mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte