PDB entry 2ga1

View 2ga1 on RCSB PDB site
Description: Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-03-07, released 2006-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein of unknown function DUF433
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_321193.1
    Database cross-references and differences (RAF-indexed):
    • GB ABA20298 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (28)
    Domains in SCOPe 2.06: d2ga1a1, d2ga1a2
  • Chain 'B':
    Compound: Protein of unknown function DUF433
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_321193.1
    Database cross-references and differences (RAF-indexed):
    • GB ABA20298 (1-End)
      • modified residue (1)
      • modified residue (28)
    Domains in SCOPe 2.06: d2ga1b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ga1A (A:)
gmnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvay
rqqgapdkellanypgltaedlsaawhyyeqnpeqidreiaqddlv

    Sequence, based on observed residues (ATOM records): (download) 
    >2ga1A (A:)
gmnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvay
rqqgapdkellanypgltaedlsaawhyyeqnpeqidreiaqd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ga1B (B:)
gmnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvay
rqqgapdkellanypgltaedlsaawhyyeqnpeqidreiaqddlv

    Sequence, based on observed residues (ATOM records): (download) 
    >2ga1B (B:)
mnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvayr
qqgapdkellanypgltaedlsaawhyyeqnpeqidreiaq