PDB entry 2g81

View 2g81 on RCSB PDB site
Description: Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with Beta-trypsin at 1.55 Angstrons Resolution
Class: hydrolase/hydrolase inhibitor
Keywords: Proteinase inhibitor, Vigna unguiculata, protein structure, Bowman-Birk inhibitor, serine proteinase, protein self-association, protein interaction, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2006-03-01, released 2007-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.155
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g81e_
  • Chain 'I':
    Compound: Bowman-Birk type seed trypsin and chymotrypsin inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17734
      • see remark 999 (19-20)
      • see remark 999 (22)
      • see remark 999 (35)
    Domains in SCOPe 2.08: d2g81i1
  • Heterogens: CA, SO4, P6G, PGE, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g81E (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >2g81I (I:)
sghhedstdeasesskpccdrcectksippqcrcsdvrlnschsackscactfsipaqcf
cgdindfcykpcksshsddddwn

    Sequence, based on observed residues (ATOM records): (download) 
    >2g81I (I:)
pccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpc