PDB entry 2g7n

View 2g7n on RCSB PDB site
Description: Structure of the Light Chain of Botulinum Neurotoxin Serotype A Bound to small Molecule Inhibitors
Class: hydrolase
Keywords: botulinum neurotoxin, zinc protease, SNAP25, HYDROLASE
Deposited on 2006-02-28, released 2007-03-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45894 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d2g7na_
  • Heterogens: ZN, AG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g7nA (A:)
    mfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaehrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkak
    siigttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvi
    nrktylnfdkavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrlknftg
    lfefy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7nA (A:)
    mfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppepvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidt
    elkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqy
    irfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaehrlygiainpnrvfkv
    ntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiig
    ttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrkt
    ylnfdkavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrlknft