PDB entry 2g4s

View 2g4s on RCSB PDB site
Description: Anomalous substructure of NBR1PB1
Class: metal binding protein
Keywords: anomalous substructure of NBR1PB1, METAL BINDING PROTEIN
Deposited on 2006-02-22, released 2007-02-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Next to BRCA1 gene 1 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: NBR1,1A13B, KIAA0049, M17S2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14596 (1-85)
    • cloning artifact (0)
  Domains in SCOPe 2.03: d2g4sa_
• Heterogens: CL, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g4sA (A:)
  amepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsin
  sqgeyeealkmavkqgnqlqmqvheg