PDB entry 2g4h

View 2g4h on RCSB PDB site
Description: Anomalous substructure of apoferritin
Class: metal binding protein
Keywords: anomalous substructure of apoferritin, METAL BINDING PROTEIN
Deposited on 2006-02-22, released 2007-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2g4ha_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g4hA (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g4hA (A:)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl