PDB entry 2g36

View 2g36 on RCSB PDB site
Description: Crystal structure of Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan-tRNA ligase)(TrpRS) (tm0492) from THERMOTOGA MARITIMA at 2.50 A resolution
Class: ligase
Keywords: tm0492, Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tryptophan-tRNA ligase)(TrpRS), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, LIGASE
Deposited on 2006-02-17, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: trpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYW2 (12-339)
      • leader sequence (11)
    Domains in SCOPe 2.07: d2g36a1, d2g36a2
  • Heterogens: SF4, TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g36A (A:)
    mgsdkihhhhhhmrilsgmrptgklhighlvgalenwvklqeegnecfyfvadwhaltth
    yddvsklkeytrdlvrgflacgidpeksvifvqsgvkehaelallfsmivsvsrlervpt
    ykeikselnykdlstagfliypvlqaadiliykaegvpvgedqvyhieltreiarrfnyl
    ydevfpepeailsrvpklpgtdgrkmsksygniinleisekeleqtilrmmtdparvrrs
    dpgnpencpvwkyhqafdiseeeskwvwegcttasigcvdckklllknmkrklapiwenf
    rkidedphyvddvimegtkkarevaaktmeevrramnlmf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g36A (A:)
    hmrilsgmrptgklhighlvgalenwvklqeegnecfyfvadwhaltthyddvsklkeyt
    rdlvrgflacgidpeksvifvqsgvkehaelallfsmivsvsrlervptykeidlstagf
    liypvlqaadiliykaegvpvgedqvyhieltreiarrfnylydevfpepeailsrvpkl
    pgtdgrkmsksygniinleisekeleqtilrmmtdparvrrsdpgnpencpvwkyhqafd
    iseeeskwvwegcttasigcvdckklllknmkrklapiwenfrkidedphyvddvimegt
    kkarevaaktmeevrramnlmf