PDB entry 2g2j

View 2g2j on RCSB PDB site
Description: Structure of the Helicase domain of the Human DDX25 RNA helicase
Class: hydrolase
Keywords: RNA, Helicase, DEAD, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-02-16, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DDX25
    Species: HOMO SAPIENS
    Gene: DDX25, GRTH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX25
    Species: HOMO SAPIENS
    Gene: DDX25, GRTH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP-dependent RNA helicase DDX25
    Species: HOMO SAPIENS
    Gene: DDX25, GRTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g2jc_
  • Chain 'D':
    Compound: ATP-dependent RNA helicase DDX25
    Species: HOMO SAPIENS
    Gene: DDX25, GRTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g2jd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g2jC (C:)
    smltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghq
    vsllsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepd
    yetylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaedmdeiekidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2jC (C:)
    ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
    llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvpdyetylhr
    igrtkglafnmievdelpslmkiqdhfnssikqlnaed
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g2jD (D:)
    smltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghq
    vsllsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepd
    yetylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaedmdeiekidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g2jD (D:)
    ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
    llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvpdyetylhr
    igrtkglafnmievdelpslmkiqdhfnssikqlnaed