PDB entry 2g11

View 2g11 on RCSB PDB site
Description: Photolyzed CO L29F Myoglobin: 31.6ns
Class: transport protein
Keywords: Time-resolved crystallography; myoglobin; difference refinement; structure-function relationship; intermediate states
Deposited on 2006-02-13, released 2006-07-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.051
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (29)
      • variant (122)
    Domains in SCOP 1.75: d2g11a1
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g11A (A:)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg