PDB entry 2g0n

View 2g0n on RCSB PDB site
Description: The Crystal Structure of the Human RAC3 in complex with GDP and Chloride
Class: signaling protein
Keywords: GTPase RAC3A, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signalling protein, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-02-13, released 2006-05-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (0)
      • cloning artifact (178)
    Domains in SCOPe 2.03: d2g0na_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (178)
    Domains in SCOPe 2.03: d2g0nb_
  • Heterogens: MG, CL, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g0nA (A:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g0nB (B:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g0nB (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg