PDB entry 2fzr

View 2fzr on RCSB PDB site
Description: Crystal structure of the N-terminal RRM of the U2AF large subunit
Class: RNA binding protein
Keywords: RNA recognition motif, RNA binding protein, RNA splicing, alternative conformations
Deposited on 2006-02-10, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-08-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.137
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: HOMO SAPIENS
    Gene: U2AF65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26368 (5-86)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d2fzra1, d2fzra2
  • Heterogens: ZN, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzrA (A:)
    gplgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflef
    rsvdettqamafdgiifqgqslkirrp