PDB entry 2fzf

View 2fzf on RCSB PDB site
Description: Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, PROTEIN STRUCTURE INITIATIVE, PSI, CONSERVED HYPOTHETICAL PROTEIN, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, Pfu-1136390-001, UNKNOWN FUNCTION
Deposited on 2006-02-09, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1190
    Database cross-references and differences (RAF-indexed):
    • GB AAL81314
    Domains in SCOPe 2.07: d2fzfa1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1190
    Database cross-references and differences (RAF-indexed):
    • GB AAL81314
    Domains in SCOPe 2.07: d2fzfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fzfA (A:)
    gstiqevreglpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlae
    eekkheallrklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeia
    aefylkleemvkeeekkrlmryladmerghyytlraeyelllnwemysqmmhigp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzfA (A:)
    glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall
    rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee
    mvkeeekkrlmryladmerghyytlraeyelllnwemy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fzfB (B:)
    gstiqevreglpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlae
    eekkheallrklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeia
    aefylkleemvkeeekkrlmryladmerghyytlraeyelllnwemysqmmhigp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fzfB (B:)
    glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall
    rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee
    mvkeeekkrlmryladmerghyytlraeyelllnwemy