PDB entry 2fyf

View 2fyf on RCSB PDB site
Description: Structure of a putative phosphoserine aminotransferase from Mycobacterium Tuberculosis
Class: transferase
Keywords: PLP-dependent enzyme, dimer, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, TRANSFERASE
Deposited on 2006-02-07, released 2007-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.145
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: SERC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fyfa_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: SERC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fyfb_
  • Heterogens: SO4, PC4, PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fyfA (A:)
    msyyhhhhhhlestslykkagfmadqltphleiptaikprdgrfgsgpskvrleqlqtlt
    ttaaalfgtshrqapvknlvgrvrsglaelfslpdgyevilgnggatafwdaaafglidk
    rslhltygefsakfasavsknpfvgepiiitsdpgsapepqtdpsvdviawahnetstgv
    avavrrpegsddalvvidatsgagglpvdiaetdayyfapqknfasdgglwlaimspaal
    srieaiaatgrwvpdflslpiavenslknqtyntpaiatlallaeqidwlvgnggldwav
    krtadssqrlyswaqerpyttpfvtdpglrsqvvgtidfvddvdagtvakilrangivdt
    epyrklgrnqlrvamfpavepddvsaltecvdwvverl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fyfA (A:)
    hleiptaikprdgrfgsgpskvrleqlqtltttaaalfgtshrqapvknlvgrvrsglae
    lfslpdgyevilgnggatafwdaaafglidkrslhltygefsakfasavsknpfvgepii
    itsdpgsapepqtdpsvdviawahnetstgvavavrrpegsdalvvidatsgagglpvdi
    aetdayyfapqknfasdgglwlaimspaalsrieaiaatgrwvpdflslpiavenslknq
    tyntpaiatlallaeqidwlvgnggldwavkrtadssqrlyswaqerpyttpfvtdpglr
    sqvvgtidfvddvdagtvakilrangivdtepyrklgrnqlrvamfpavepddvsaltec
    vdwvverl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fyfB (B:)
    msyyhhhhhhlestslykkagfmadqltphleiptaikprdgrfgsgpskvrleqlqtlt
    ttaaalfgtshrqapvknlvgrvrsglaelfslpdgyevilgnggatafwdaaafglidk
    rslhltygefsakfasavsknpfvgepiiitsdpgsapepqtdpsvdviawahnetstgv
    avavrrpegsddalvvidatsgagglpvdiaetdayyfapqknfasdgglwlaimspaal
    srieaiaatgrwvpdflslpiavenslknqtyntpaiatlallaeqidwlvgnggldwav
    krtadssqrlyswaqerpyttpfvtdpglrsqvvgtidfvddvdagtvakilrangivdt
    epyrklgrnqlrvamfpavepddvsaltecvdwvverl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fyfB (B:)
    hleiptaikprdgrfgsgpskvrleqlqtltttaaalfgtshrqapvknlvgrvrsglae
    lfslpdgyevilgnggatafwdaaafglidkrslhltygefsakfasavsknpfvgepii
    itsdpgsapepqtdpsvdviawahnetstgvavavrrpegsdalvvidatsgagglpvdi
    aetdayyfapqknfasdgglwlaimspaalsrieaiaatgrwvpdflslpiavenslknq
    tyntpaiatlallaeqidwlvgnggldwavkrtadssqrlyswaqerpyttpfvtdpglr
    sqvvgtidfvddvdagtvakilrangivdtepyrklgrnqlrvamfpavepddvsaltec
    vdwvverl