PDB entry 2fyd

View 2fyd on RCSB PDB site
Description: catalytic domain of bovine beta 1, 4-galactosyltransferase in complex with alpha-lactalbumin, glucose, Mn, and UDP-N-acetylgalactosamine
Class: transferase
Keywords: lactose sythase, catalytic intermediate, TRANSFERASE
Deposited on 2006-02-07, released 2006-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fyda_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAM54035 (Start-285)
      • engineered (195)
      • engineered (225)
      • engineered (284)
    Domains in SCOPe 2.06: d2fydb1
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fydc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAM54035 (Start-285)
      • engineered (195)
      • engineered (225)
      • engineered (284)
    Domains in SCOPe 2.06: d2fydd_
  • Heterogens: BGC, NGA, CA, MN, UDP, PG4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fydA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fydB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fydB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtcs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fydC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fydD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fydD (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtcs