PDB entry 2fxd

View 2fxd on RCSB PDB site
Description: X-ray crystal structure of HIV-1 protease IRM mutant complexed with atazanavir (BMS-232632)
Class: hydrolase
Keywords: human immunodeficiency virus (hiv), hiv-1 protease, reyataz, atazanavir, bms-232632, hydrolase
Deposited on 2006-02-04, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.235
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • GB AAM81794 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (12)
      • engineered (32)
      • engineered (36)
      • engineered (40)
      • engineered (45)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (83)
      • engineered (89)
      • engineered (94)
    Domains in SCOPe 2.07: d2fxda_
  • Chain 'B':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • GB AAM81794 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (12)
      • engineered (32)
      • engineered (36)
      • engineered (40)
      • engineered (45)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (83)
      • engineered (89)
      • engineered (94)
    Domains in SCOPe 2.07: d2fxdb_
  • Heterogens: SO4, ACT, DR7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fxdA (A:)
    pqitlwkrpivtvkiggqlkealldtgaddtvieemnlpgkwkpkiiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpfnvigrnlmtqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fxdB (B:)
    pqitlwkrpivtvkiggqlkealldtgaddtvieemnlpgkwkpkiiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpfnvigrnlmtqigatlnf