PDB entry 2fx8

View 2fx8 on RCSB PDB site
Description: Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41
Class: immune system
Keywords: immunoglobulin fold, beta-sandwich, antibody-epitope complex
Deposited on 2006-02-03, released 2006-12-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-04, with a file datestamp of 2007-08-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8h1, d2fx8h2
  • Chain 'I':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8i1, d2fx8i2
  • Chain 'J':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8j1, d2fx8j2
  • Chain 'K':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8k1, d2fx8k2
  • Chain 'L':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8l1, d2fx8l2
  • Chain 'M':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8m1, d2fx8m2
  • Chain 'N':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8n1, d2fx8n2
  • Chain 'O':
    Compound: Fab 4E10
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d2fx8o1, d2fx8o2
  • Chain 'P':
    Compound: Fragment of HIV glycoprotein (GP41)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-11)
      • modified residue (7)
      • engineered (10-11)
  • Chain 'Q':
    Compound: Fragment of HIV glycoprotein (GP41)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-11)
      • modified residue (7)
      • engineered (10-11)
  • Chain 'R':
    Compound: Fragment of HIV glycoprotein (GP41)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-11)
      • modified residue (7)
      • engineered (10-11)
  • Chain 'S':
    Compound: Fragment of HIV glycoprotein (GP41)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-11)
      • modified residue (7)
      • engineered (10-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8H (H:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8I (I:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8J (J:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8K (K:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8L (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8M (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8N (N:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx8O (O:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.