PDB entry 2fx3

View 2fx3 on RCSB PDB site
Description: Crystal Structure Determination of E. coli Elongation Factor, Tu using a Twinned Data Set
Class: translation
Keywords: EF-Tu, merohedral twinning, TRANSLATION
Deposited on 2006-02-03, released 2006-03-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.197
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fx3a1, d2fx3a2, d2fx3a3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fx3A (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fx3A (A:)
    rtkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintsh
    veydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvg
    vpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewea
    kilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivg
    iketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfes
    evyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpi
    amddglrfaireggrtvgagvvakvlg