PDB entry 2fwl

View 2fwl on RCSB PDB site
Description: The cytochrome c552/CuA complex from Thermus thermophilus
Class: electron transport/oxidoreductase
Keywords: docking calculations, redox protein complex, electron transfer pathway, ELECTRON TRANSPORT-OXIDOREDUCTASE COMPLEX
Deposited on 2006-02-02, released 2006-03-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fwla1
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fwlb1
  • Heterogens: HEC, CUA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fwlA (A:)
    maqadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqi
    evkgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltp
    qqvlaerkklglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwlA (A:)
    dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
    mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
    aerkklglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fwlB (B:)
    maytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqp
    npievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqy
    cglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwlB (B:)
    ytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnp
    ievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycg
    lghqnmfgtivvke