PDB entry 2fum

View 2fum on RCSB PDB site
Description: Catalytic domain of protein kinase PknB from Mycobacterium tuberculosis in complex with mitoxantrone
Class: transferase
Keywords: protein kinase-inhibitor complex, transferase
Deposited on 2006-01-27, released 2006-08-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.221
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pknB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fuma_
  • Chain 'B':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pknB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fumb_
  • Chain 'C':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pknB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fumc_
  • Chain 'D':
    Compound: Probable serine/threonine-protein kinase pknB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pknB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fumd_
  • Heterogens: MIX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fumA (A:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fumA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadgtaqylspeqargdsvd
    arsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlka
    laknpenryqtaaemradlvrvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fumB (B:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fumB (B:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraigtaqylspeqargdsvdar
    sdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkala
    knpenryqtaaemradlvrvhn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fumC (C:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fumC (C:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfaqylspeqargdsvdarsdvyslgc
    vlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenryq
    taaemradlvrvhn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fumD (D:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fumD (D:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiigtaqylspeqargdsvdarsdv
    yslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknp
    enryqtaaemradlvrvh