PDB entry 2fu5

View 2fu5 on RCSB PDB site
Description: structure of Rab8 in complex with MSS4
Class: signaling protein
Keywords: MSS4:Rab8 protein complex, GEF:GTPase nucleotide free complex, nucleotide exchange via unfolding of nucleotide binding region, SIGNALING PROTEIN
Deposited on 2006-01-26, released 2006-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide exchange factor MSS4
    Species: Homo sapiens [TaxId:9606]
    Gene: RABIF, MSS4, RASGRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47224 (4-116)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d2fu5a1, d2fu5a2
  • Chain 'B':
    Compound: Guanine nucleotide exchange factor MSS4
    Species: Homo sapiens [TaxId:9606]
    Gene: RABIF, MSS4, RASGRF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47224 (4-116)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d2fu5b2, d2fu5b3
  • Chain 'C':
    Compound: Ras-related protein Rab-8A
    Species: Mus musculus [TaxId:10090]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu5c1
  • Chain 'D':
    Compound: Ras-related protein Rab-8A
    Species: Mus musculus [TaxId:10090]
    Gene: Rab8a, Mel, Rab8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fu5d_
  • Heterogens: ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fu5A (A:)
    qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllq
    ehwlvedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu5A (A:)
    qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkdgdllqehwlvedmfi
    fenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fu5B (B:)
    qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllq
    ehwlvedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu5B (B:)
    qghmvsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkdgdllqehwlvedmfi
    fenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fu5C (C:)
    maktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklq
    iwdtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilg
    nkcdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdknwkat
    aag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu5C (C:)
    ktydylfkllligdsgvtfistigidfkirtieldgkriklqiwdtttayyrgamgimlv
    yditneksfdnirnwirnieehasadvekmilgnkvndkrqvskergeklaldygikfme
    tsainvenafftlardikakmdknwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fu5D (D:)
    maktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklq
    iwdtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilg
    nkcdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdknwkat
    aag
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fu5D (D:)
    ktydylfkllligdsafnstfistigidfkirtieldgkriklqiwdtagqerfrtitta
    yyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkdvdkrqvskergek
    laldygikfmetaninvenafftlardikakmdknwk