PDB entry 2fr7

View 2fr7 on RCSB PDB site
Description: Crystal Structure of Cytochrome P450 CYP199A2
Class: oxidoreductase
Keywords: P450 Family Protein Fold, OXIDOREDUCTASE
Deposited on 2006-01-19, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: CYP199A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fr7a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fr7A (A:)
    mttapslvpvttpsqhgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygv
    aryaevyavlndpltfcssrgvglsdfkkekpwrppslileadppahtrtravlskvlsp
    atmkrlrdgfaaaadakidellarggnidaiadlaeayplsvfpdamglkqegrenllpy
    aglvfnafgppnelrqsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpee
    apllvrsllsagldttvngiaaavyclarfpdefarlradpslarnafeeavrfespvqt
    ffrtttrdvelagatigegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhm
    cvgqlvarlegevvlaalarkvaaieiagplkrrfnntlrgleslpiqltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fr7A (A:)
    hgagvphlgidpfaldyfadpypeqetlreagpvvyldkwnvygvaryaevyavlndplt
    fcssrgvglsdfkkekpwrppslileadppahtrtravlskvlspatmkrlrdgfaaaad
    akidellarggnidaiadlaeayplsvfpdamglkqegrenllpyaglvfnafgppnelr
    qsaiersaphqayvaeqcqrpnlapggfgacihafsdtgeitpeeapllvrsllsagldt
    tvngiaaavyclarfpdefarlradpslarnafeeavrfespvqtffrtttrdvelagat
    igegekvlmflgsanrdprrwddpdryditrktsghvgfgsgvhmcvgqlvarlegevvl
    aalarkvaaieiagplkrrfnntlrgleslpiqltpa