PDB entry 2fpq

View 2fpq on RCSB PDB site
Description: Crystal Structure of Botulinum Neurotoxin Type D Light Chain
Class: toxin
Keywords: hexxh metalloprotease, toxin
Deposited on 2006-01-16, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.184
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin d light chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: BOTD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19321 (8-End)
      • cloning artifact (6-7)
    Domains in SCOPe 2.07: d2fpqa1, d2fpqa2
  • Heterogens: ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fpqA (A:)
    gplgspefmtwpvkdfnysdpvndndilylripqnklittpvkafmitqniwviperfss
    dtnpslskpprptskyqsyydpsylstdeqkdtflkgiiklfkrinerdigkklinylvv
    gspfmgdsstpedtfdftrhttniavekfengswkvtniitpsvlifgplpnildytasl
    tlqgqqsnpsfegfgtlsilkvapeflltfsdvtsnqssavlgksifcmdpvialmhelt
    hslhqlyginipsdkrirpqvsegffsqdgpnvqfeelytfggldveiipqiersqlrek
    alghykdiakrlnninktipsswisnidkykkifsekynfdkdntgnfvvnidkfnslys
    dltnvmsevvyssqynvknrthyfsrhylpvfanilddniytirdgfnltnkgfniensg
    qniernpalqklssesvvdlftkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fpqA (A:)
    efmtwpvkdfnysdpvndndilylripqnklittpvkafmitqniwviperfssdtnpsl
    skpprptskyqsyydpsylstdeqkdtflkgiiklfkrinerdigkklinylvvgspfmg
    dsstpedtfdftrhttniavekfengswkvtniitpsvlifgplpnildytasltlqsnp
    sfegfgtlsilkvapeflltfsdvgksifcmdpvialmhelthslhqlyginipsdkrir
    pqvsegffsqdgpnvqfeelytfggldveiipqiersqlrekalghykdiakrlnninkt
    ipsswisnidkykkifsekynfdkdntgnfvvnidkfnslysdltnvmsevvyssqynvk
    nrthyfsrhylpvfanilddniytirdgfnltnkgfniensgqniernpalqkl