PDB entry 2fp7

View 2fp7 on RCSB PDB site
Description: West Nile Virus NS2B/NS3protease in complex with Bz-Nle-Lys-Arg-Arg-H
Class: hydrolase/hydrolase inhibitor
Keywords: Flavivirus, NS3 protease, NS2B cofactor, substrate-based inhibitor, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2006-01-16, released 2006-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease subunit NS2B
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06935 (6-End)
      • cloning artifact (5)
    • PDB 2FP7
  • Chain 'B':
    Compound: Serine protease NS3
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fp7b1
  • Chain 'C':
    Compound: N-benzoyl-L-norleucyl-L-lysyl-N-[(2S)-5-carbamimidamido-1-hydroxypentan-2-yl]-L-argininamide
    Database cross-references and differences (RAF-indexed):
    • PDB 2FP7 (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fp7B (B:)
    gdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvked
    rlcyggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgts
    gspivdkngdviglygngvimpngsyisaivqgermeepapagfepemlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp7B (B:)
    ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw
    klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn
    gdviglygngvimpngsyisaivqger
    

  • Chain 'C':
    No sequence available.