PDB entry 2fp7

View 2fp7 on RCSB PDB site
Description: West Nile Virus NS2B/NS3protease in complex with Bz-Nle-Lys-Arg-Arg-H
Class: viral protein/protease
Keywords: Flavivirus, NS3 protease, NS2B cofactor, substrate-based inhibitor
Deposited on 2006-01-16, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: West Nile virus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06935 (6-End)
      • cloning artifact (5)
  • Chain 'B':
    Compound: Polyprotein
    Species: West Nile virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fp7b1
  • Heterogens: NDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2fp7B (B:)
gdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvked
rlcyggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgts
gspivdkngdviglygngvimpngsyisaivqgermeepapagfepemlrkk

    Sequence, based on observed residues (ATOM records): (download) 
    >2fp7B (B:)
ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw
klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn
gdviglygngvimpngsyisaivqger