PDB entry 2fow

View 2fow on RCSB PDB site
Description: the RNA binding domain of ribosomal protein l11: three-dimensional structure of the RNA-bound form of the protein, nmr, 26 structures
Class: ribosome
Keywords: ribosome, protein:RNA, thiostrepton
Deposited on 1997-05-26, released 1997-11-26
The last revision prior to the SCOP 1.75 freeze date was dated 1997-11-26, with a file datestamp of 2007-06-04.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosomal protein l11
  Species: Bacillus stearothermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56210 (1-75)
  Domains in SCOP 1.75: d2fowa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fowA (A:)
  mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
  rmiegtarsmgivved