PDB entry 2fon

View 2fon on RCSB PDB site
Description: X-ray crystal structure of LeACX1, an acyl-CoA oxidase from Lycopersicon esculentum (tomato)
Class: oxidoreductase
Keywords: oxidoreductase, peroxisomal beta-oxidation, FAD cofactor
Deposited on 2006-01-13, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal acyl-CoA oxidase 1A
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: ACX1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fona1, d2fona2, d2fona3
  • Chain 'B':
    Compound: peroxisomal acyl-CoA oxidase 1A
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: ACX1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fonb1, d2fonb2, d2fonb3
  • Chain 'C':
    Compound: peroxisomal acyl-CoA oxidase 1A
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: ACX1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fonc1, d2fonc2, d2fonc3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fonA (A:)
    mrgshhhhhhgsacelvremegvdyladerkkagfdvdemkivwagsrhdfeltdriskl
    vasdpgfskegrtmlprkelfkntlrkaayawkriielrlsqeeatmlrryvdepaftdl
    hwgmfipaikgqgtdkqqekwlplaykmqiigcyaqtelghgsnvqglettatfdpqtde
    fvihsptltsskwwpgglgkvsthavvyarlitdgkdygvngfivqlrsledhkplpgvt
    vgdigmkfgngaynsmdngvlsfdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtm
    vyvrqsivadaslamsravciatrysavrrqfgsqnggqetqvidyktqqnrlfpllasa
    yafrfvgewlkwlytdvtqrlaandfstlpeahactaglkslttsatadgieecrklcgg
    hgylcssglpelfavyvpactyegdnvvlqlqvarflmktisqlgtgkkpvgtvsymgri
    ehlmqcrsdvkqaedwlkpsavleafearsarmsvacaknlskfenqeegfaelaadlve
    aavahcqlivvskyieklqqnipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskq
    gslandqlralysqlrpnavslvdafnytdhylgsilgrydgnvypklyeaawkdplnks
    diadgfheyirpllkqqlrtakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fonA (A:)
    gvdyladerkkagfdvdemkivwagsrhdfeltdrisklvasdpgfskegrtmlprkelf
    kntlrkaayawkriielrlsqeeatmlrryvdepaftdlhwgmfipaikgqgtdkqqekw
    lplaykmqiigcyaqtelghgsnvqglettatfdpqtdefvihsptltsskwwpgglgkv
    sthavvyarlitdgkdygvngfivqlrsledhkplpgvtvgdigmkfgngaynsmdngvl
    sfdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtmvyvrqsivadaslamsravci
    atrysavrrqfgsqnggqetqvidyktqqnrlfpllasayafrfvgewlkwlytdvtqrl
    aandfstlpeahactaglkslttsatadgieecrklcgghgylcssglpelfavyvpact
    yegdnvvlqlqvarflmktisqlgtgkkpvgtvsymgriehlmqcrsdvkqaedwlkpsa
    vleafearsarmsvacaknlskfenqeegfaelaadlveaavahcqlivvskyieklqqn
    ipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskqgslandqlralysqlrpnavs
    lvdafnytdhylgsilgrydgnvypklyeaawkdplnksdiadgfheyirpllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fonB (B:)
    mrgshhhhhhgsacelvremegvdyladerkkagfdvdemkivwagsrhdfeltdriskl
    vasdpgfskegrtmlprkelfkntlrkaayawkriielrlsqeeatmlrryvdepaftdl
    hwgmfipaikgqgtdkqqekwlplaykmqiigcyaqtelghgsnvqglettatfdpqtde
    fvihsptltsskwwpgglgkvsthavvyarlitdgkdygvngfivqlrsledhkplpgvt
    vgdigmkfgngaynsmdngvlsfdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtm
    vyvrqsivadaslamsravciatrysavrrqfgsqnggqetqvidyktqqnrlfpllasa
    yafrfvgewlkwlytdvtqrlaandfstlpeahactaglkslttsatadgieecrklcgg
    hgylcssglpelfavyvpactyegdnvvlqlqvarflmktisqlgtgkkpvgtvsymgri
    ehlmqcrsdvkqaedwlkpsavleafearsarmsvacaknlskfenqeegfaelaadlve
    aavahcqlivvskyieklqqnipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskq
    gslandqlralysqlrpnavslvdafnytdhylgsilgrydgnvypklyeaawkdplnks
    diadgfheyirpllkqqlrtakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fonB (B:)
    gvdyladerkkagfdvdemkivwagsrhdfeltdrisklvasdpgfskegrtmlprkelf
    kntlrkaayawkriielrlsqeeatmlrryvdepaftdlhwgmfipaikgqgtdkqqekw
    lplaykmqiigcyaqtelghgsnvqglettatfdpqtdefvihsptltsskwwpgglgkv
    sthavvyarlitdgkdygvngfivqlrsledhkplpgvtvgdigmkfgngaynsmdngvl
    sfdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtmvyvrqsivadaslamsravci
    atrysavrrqfgsqnggqetqvidyktqqnrlfpllasayafrfvgewlkwlytdvtqrl
    aandfstlpeahactaglkslttsatadgieecrklcgghgylcssglpelfavyvpact
    yegdnvvlqlqvarflmktisqlgtgkkpvgtvsymgriehlmqcrsdvkqaedwlkpsa
    vleafearsarmsvacaknlskfenqeegfaelaadlveaavahcqlivvskyieklqqn
    ipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskqgslandqlralysqlrpnavs
    lvdafnytdhylgsilgrydgnvypklyeaawkdplnksdiadgfheyirpllkqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fonC (C:)
    mrgshhhhhhgsacelvremegvdyladerkkagfdvdemkivwagsrhdfeltdriskl
    vasdpgfskegrtmlprkelfkntlrkaayawkriielrlsqeeatmlrryvdepaftdl
    hwgmfipaikgqgtdkqqekwlplaykmqiigcyaqtelghgsnvqglettatfdpqtde
    fvihsptltsskwwpgglgkvsthavvyarlitdgkdygvngfivqlrsledhkplpgvt
    vgdigmkfgngaynsmdngvlsfdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtm
    vyvrqsivadaslamsravciatrysavrrqfgsqnggqetqvidyktqqnrlfpllasa
    yafrfvgewlkwlytdvtqrlaandfstlpeahactaglkslttsatadgieecrklcgg
    hgylcssglpelfavyvpactyegdnvvlqlqvarflmktisqlgtgkkpvgtvsymgri
    ehlmqcrsdvkqaedwlkpsavleafearsarmsvacaknlskfenqeegfaelaadlve
    aavahcqlivvskyieklqqnipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskq
    gslandqlralysqlrpnavslvdafnytdhylgsilgrydgnvypklyeaawkdplnks
    diadgfheyirpllkqqlrtakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fonC (C:)
    vdyladerkkagfdvdemkivwagsrhdfeltdrisklvasdpgfskegrtmlprkelfk
    ntlrkaayawkriielrlsqeeatmlrryvdepaftdlhwgmfipaikgqgtdkqqekwl
    playkmqiigcyaqtelghgsnvqglettatfdpqtdefvihsptltsskwwpgglgkvs
    thavvyarlitdgkdygvngfivqlrsledhkplpgvtvgdigmkfgngaynsmdngvls
    fdhvriprdqmlmrvsqvtkegkyvqsdiprqllygtmvyvrqsivadaslamsravcia
    trysavrrqfgsqnggqetqvidyktqqnrlfpllasayafrfvgewlkwlytdvtqrla
    andfstlpeahactaglkslttsatadgieecrklcgghgylcssglpelfavyvpacty
    egdnvvlqlqvarflmktisqlgtgkkpvgtvsymgriehlmqcrsdvkqaedwlkpsav
    leafearsarmsvacaknlskfenqeegfaelaadlveaavahcqlivvskyieklqqni
    pgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskqgslandqlralysqlrpnavsl
    vdafnytdhylgsilgrydgnvypklyeaawkdplnksdiadgfheyirpllk