PDB entry 2fol

View 2fol on RCSB PDB site
Description: Crystal structure of human RAB1A in complex with GDP
Class: protein transport
Keywords: G-PROTEIN, RAB, GTP ANALOGUE, STRUCTURAL GENOMICS, STRUCT URAL GENOMICS CONSORTIUM, SGC, Structural Genomics Consortium, PROTEIN TRANSPORT
Deposited on 2006-01-13, released 2006-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.199
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1A, RAB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fola1
  • Heterogens: MG, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2folA (A:)
    mgsshhhhhhssglvprgspeydylfkllligdsgvgksclllrfaddtytesyistigv
    dfkirtieldgktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwl
    qeidryasenvnkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfm
    tmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2folA (A:)
    ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdy
    rgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkcdlttkkvvdyttake
    fadslgipfletsaknatnveqsfmtmaaeikkrm